Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

и другие.

Frontiers in Microbiology, Год журнала: 2024, Номер 15

Опубликована: Дек. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Язык: Английский

Use of biological control agents for managing fungal pathogens in Solanaceae crops: progress and future perspectives—a review DOI Creative Commons

Sinhle Madlhophe,

Udoka Vitus Ogugua, Fikile Nelly Makhubu

и другие.

Deleted Journal, Год журнала: 2025, Номер 7(1)

Опубликована: Янв. 15, 2025

The growing global population has intensified concerns about food security, making it essential to produce crops sustainably meet increasing demands without harming the environment. In this regard, biological control agents (BCAs) have recently gained more attention owing their potential manage fungal diseases of crops, particularly in Solanaceae family. proper use selected BCAs such as Trichoderma spp., Bacillus Pseudomonas fluorescens, Beauveria bassiana, and Gliocladium spp. several benefits for crops. This review aims summarize effectiveness various strategies We also provide basic knowledge on along with suggestions further research reduce severity these destructive diseases.

Язык: Английский

Процитировано

2

A Review on Biocontrol Agents as Sustainable Approach for Crop Disease Management: Applications, Production, and Future Perspectives DOI Creative Commons
Anshika Tyagi, Tensangmu Lama Tamang, Hamdy Kashtoh

и другие.

Horticulturae, Год журнала: 2024, Номер 10(8), С. 805 - 805

Опубликована: Июль 30, 2024

Horticultural crops are vulnerable to diverse microbial infections, which have a detrimental impact on their growth, fruit quality, and productivity. Currently, chemical pesticides widely employed manage diseases in horticultural crops, but they negative effects the environment, human health, soil physiochemical properties, biodiversity. Additionally, use of has facilitated development spread resistant pathovars, emerged as serious concern contemporary agriculture. Nonetheless, adverse consequences environment public health worried scientists greatly recent years, led switch biocontrol agents such bacteria, fungi, insects control plant pathogens. Biocontrol (BCAs) form an integral part organic farming, is regarded future sustainable Hence, harnessing potential BCAs important viable strategy disease way that also ecofriendly can improve health. Here, we discuss role biological crops. We different microbial-based fungal, bacterial, viral management. Next, factors affect performance under field conditions. This review highlights genetic engineering enhance efficiency other growth traits. Finally, highlight challenges opportunities biocontrol-based management horticulture research directions boost efficacy applications.

Язык: Английский

Процитировано

9

Enhancing Plant Disease Resistance: Insights from Biocontrol Agent Strategies DOI
Asha Rani Sheoran, Nita Lakra, Baljeet Singh Saharan

и другие.

Journal of Plant Growth Regulation, Год журнала: 2024, Номер unknown

Опубликована: Сен. 5, 2024

Язык: Английский

Процитировано

6

Employing Bacillus and Pseudomonas for phytonematode management in agricultural crops DOI
Rupali Gupta,

Gautam Anand,

Rakesh Pandey

и другие.

World Journal of Microbiology and Biotechnology, Год журнала: 2024, Номер 40(11)

Опубликована: Окт. 3, 2024

Язык: Английский

Процитировано

1

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

и другие.

Frontiers in Microbiology, Год журнала: 2024, Номер 15

Опубликована: Дек. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Язык: Английский

Процитировано

0