Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

и другие.

Frontiers in Microbiology, Год журнала: 2024, Номер 15

Опубликована: Дек. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Язык: Английский

Potential and Limitation of Peptides from Native Plants of Uttarakhand DOI
Neha Kamboj, Rahul Kumar, Navin Kumar

и другие.

International Journal of Peptide Research and Therapeutics, Год журнала: 2024, Номер 30(5)

Опубликована: Сен. 3, 2024

Язык: Английский

Процитировано

1

Recent Progress in Terrestrial Biota Derived Antibacterial Agents for Medical Applications DOI Creative Commons
T. Vladkova, Younes Smani, Boris L. Martinov

и другие.

Molecules, Год журнала: 2024, Номер 29(20), С. 4889 - 4889

Опубликована: Окт. 15, 2024

Conventional antibiotic and multidrug treatments are becoming less effective the discovery of new safe antibacterial agents is a global priority. Returning to natural product relatively current trend. Terrestrial biota rich source biologically active substances whose potential has not been fully utilized. The aim this review present state-of-the-art terrestrial biota-derived inspired by treatments. It summarizes most important sources newly identified or modified from last five years. focuses on significance plant- animal- bacteria-derived as powerful alternatives antibiotics, well advantages utilizing molecules alone in combination with antibiotics. main conclusion that products open variety ways for modern improved therapeutic strategies. New known were discovered during 5 years, which under investigation together some long-ago but now experiencing their renaissance development medical use peptides combinational therapy commercial antibiotics outlined promising method treating bacterial infections. In vivo testing clinical trials necessary reach application.

Язык: Английский

Процитировано

1

The Potential Effect of Endogenous Antimicrobial Peptides in Cancer Immunotherapy and Prevention DOI Creative Commons
Tuan Hiep Tran,

Thanh Huong Le,

Thi Thu Phuong Tran

и другие.

Journal of Peptide Science, Год журнала: 2024, Номер 31(2)

Опубликована: Дек. 23, 2024

ABSTRACT Antimicrobial peptides (AMPs) are crucial constituents of inherent immunity and serve as vital components human host defense, playing a pivotal role in combating invading microbial pathogens. Beyond their antimicrobial functions, AMPs also exhibit various other biological activities including apoptosis induction, wound healing promotion, immune modulation. These found exposed tissues or surfaces throughout the body, such eyes, skin, mouth, ears, respiratory tract, lungs, digestive, urinary system. Additionally, certain LL‐37, HNP, lactoferrin have shown potential candidates for anticancer activity. Given limited selectivity between normal cancer cells exhibited by many current immunotherapeutic agents, properties make them promising treatment. Their abundance, bioavailability, safety profile, efficiency, harmony with system position attractive tools fight against cancer. This review is aimed at exploring elucidating relationship immunology immunotherapy.

Язык: Английский

Процитировано

1

Chemokines Kill Bacteria by Binding Anionic Phospholipids without Triggering Antimicrobial Resistance DOI Creative Commons
Sergio M. Pontejo,

S. Burillo Martínez,

Allison Zhao

и другие.

bioRxiv (Cold Spring Harbor Laboratory), Год журнала: 2024, Номер unknown

Опубликована: Июль 25, 2024

ABSTRACT Classically, chemokines coordinate leukocyte trafficking during immune responses; however, many have also been reported to possess direct antibacterial activity in vitro. Yet, the bacterial killing mechanism of and biochemical properties that define which members chemokine superfamily are antimicrobial remain poorly understood. Here we report is defined by their ability bind phosphatidylglycerol cardiolipin, two anionic phospholipids commonly found plasma membrane. We show only able these kill Escherichia coli Staphylococcus aureus they exert rapid bacteriostatic bactericidal effects against E. with a higher potency than peptide beta-defensin 3. Furthermore, our data support membrane cardiolipin facilitates action chemokines. Both genetic interference chemokine-cardiolipin interaction impaired microbial growth arrest, killing, disruption Moreover, unlike conventional antibiotics, failed develop resistance when placed under increasing pressure Thus, identified as novel binding partners for responsible action. Our results provide proof principle developing antibiotics resistant mechanisms.

Язык: Английский

Процитировано

0

An Optimization Method for Drug Design Based on Molecular Features DOI
Xuan Liu,

Xiaoli Lin,

Fengli Zhou

и другие.

Lecture notes in computer science, Год журнала: 2024, Номер unknown, С. 27 - 36

Опубликована: Янв. 1, 2024

Язык: Английский

Процитировано

0

Host Defense Peptides: Exploiting an Innate Immune Component Against Infectious Diseases and Cancer DOI
Taiwo Scholes Adewole, Oladiran Boniface Oladokun, Adenike Kuku

и другие.

International Journal of Peptide Research and Therapeutics, Год журнала: 2024, Номер 30(6)

Опубликована: Окт. 5, 2024

Язык: Английский

Процитировано

0

Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

и другие.

Frontiers in Microbiology, Год журнала: 2024, Номер 15

Опубликована: Дек. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Язык: Английский

Процитировано

0