Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

et al.

Frontiers in Microbiology, Journal Year: 2024, Volume and Issue: 15

Published: Dec. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Language: Английский

Virulence Regulation in Plant-Pathogenic Bacteria by Host-Secreted Signals DOI Creative Commons
Muhammad Asif, Xin Xie, Zhibo Zhao

et al.

Microbiological Research, Journal Year: 2024, Volume and Issue: 288, P. 127883 - 127883

Published: Aug. 24, 2024

Bacterial pathogens manipulate host signaling pathways and evade defenses using effector molecules, coordinating their deployment to ensure successful infection. However, host-derived metabolites as signals, critical role in regulating bacterial virulence requires further insights. Effective regulation of virulence, which is essential for pathogenic bacteria, involves controlling factors that enable colonization, defense evasion, tissue damage. This dynamic, influenced by environmental cues including signals from plants like exudates. Plant exudates, comprising diverse compounds released roots tissues, serve rich chemical affecting the behavior associated bacteria. nutrients act molecules are sensed through membrane-localized receptors intracellular response mechanisms review explains how different bacteria detect answer secreted gene expression. Our main emphasis exploring recognition process host-originated molecular sensors on cellular membranes pathways. encompasses insights into strains individually coordinate various distinct can positively or negatively regulate virulence. Furthermore, we explained interruption plant with perception dampen pathogen The intricate interplay between particularly recognize metabolic genes, portrays a crucial initial interaction leading profound influences infection outcomes. work will greatly aid researchers developing new strategies preventing treating infections.

Language: Английский

Citations

4
Genomics in infectious disease DOI
Kaushika Olymon, Ankita Kumari, Aditya Kumar

et al.

Elsevier eBooks, Journal Year: 2025, Volume and Issue: unknown, P. 225 - 259

Published: Jan. 1, 2025

Language: Английский

Citations

0
Exploring the multifaceted role of pehR in Ralstonia solanacearum pathogenesis: enzyme activity, motility, and biofilm formation DOI
Sharmilee Sarkar, Mohit Yadav, Upalabdha Dey

et al.

Microbiological Research, Journal Year: 2024, Volume and Issue: 290, P. 127925 - 127925

Published: Oct. 17, 2024

Language: Английский

Citations

1
Decomposition solutions from brassica and cereal residues suppress tomato bacterial wilt disease by regulating rhizosphere microbial communities DOI

Danmei Gao,

Zhenxing Fang,

Xinjie Pan

et al.

Microbiological Research, Journal Year: 2024, Volume and Issue: 292, P. 128010 - 128010

Published: Dec. 13, 2024

Language: Английский

Citations

1
Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

et al.

Frontiers in Microbiology, Journal Year: 2024, Volume and Issue: 15

Published: Dec. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Language: Английский

Citations

0