Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

et al.

Frontiers in Microbiology, Journal Year: 2024, Volume and Issue: 15

Published: Dec. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Language: Английский

Root exudates and microbial metabolites: signals and nutrients in plant-microbe interactions DOI
Xiaoyan Fan, An‐Hui Ge, Shanshan Qi

et al.

Science China Life Sciences, Journal Year: 2025, Volume and Issue: unknown

Published: March 11, 2025

Language: Английский

Citations

1
The Small Key to the Treasure Chest: Endogenous Plant Peptides Involved in Symbiotic Interactions DOI Creative Commons
Anna Mamaeva,

Arina Makeeva,

Daria Ganaeva

et al.

Plants, Journal Year: 2025, Volume and Issue: 14(3), P. 378 - 378

Published: Jan. 26, 2025

Plant growth and development are inextricably connected with rhizosphere organisms. Plants have to balance between strong defenses against pathogens while modulating their immune responses recruit beneficial organisms such as bacteria fungi. In recent years, there has been increasing evidence that regulatory peptides essential in establishing these symbiotic relationships, orchestrating processes include nutrient acquisition, root architecture modification, modulation. this review, we provide a comprehensive summary of the peptide families facilitate relationships plants

Language: Английский

Citations

0
Harnessing omics to decode the mechanisms of symbiotic nitrogen fixation DOI Creative Commons
Keyi Ye, Jianshu Zheng,

Zhaonian Dong

et al.

aBIOTECH, Journal Year: 2025, Volume and Issue: unknown

Published: March 26, 2025

Language: Английский

Citations

0
The emergence and loss of cyclic peptides in Nicotiana illuminate dynamics and mechanisms of plant metabolic evolution DOI Creative Commons

Elliot M. Suh,

Jakob K. Reinhardt, Jing‐Ke Weng

et al.

Proceedings of the National Academy of Sciences, Journal Year: 2025, Volume and Issue: 122(16)

Published: April 14, 2025

Specialized metabolism plays a central role in how plants cope with both biotic and abiotic stresses order to survive reproduce within dynamic challenging environments. One recently described class of plant-specific, ribosomally synthesized, posttranslationally modified peptides are the burpitides, which characterized by installation distinct sidechain macrocycles enzymes known as burpitide cyclases. While they found across many plant families exhibit diverse bioactivities, little is about their evolution or new variants arise. Here, we present identification cyclase, resurrected from defunct pseudogene model organism Nicotiana attenuata , coyote tobacco. By repairing ΨNatBURP2 expressing it heterologously benthamiana successfully reconstituted its original enzymatic activity. As an autocatalytic peptide installs unique C–C bond between tyrosine side chain specific backbone α-carbon heptapeptide core motif, resulting burpitides dubbed “nanamins.” Despite pseudogenization N. that closely related species, clevelandii retains wild-type gene produces nanamins. Phylogenetic analyses targeted mutagenesis experiments reveal this chemotype must have evolved duplication neofunctionalization more promiscuous ancestral gene. This work highlights novel chemotypes may rapidly emerge disappear plants, while expanding molecular toolkit for engineering applications agriculture drug discovery.

Language: Английский

Citations

0
Effects of Soil Physicochemical Properties on Bacterial Community Dynamics in Grassland Ecosystems DOI Open Access
Jinming Lu, Haibo Xiang, Hao Li

et al.

American Journal of Molecular Biology, Journal Year: 2025, Volume and Issue: 15(02), P. 212 - 225

Published: Jan. 1, 2025

Language: Английский

Citations

0
Spodoptera frugiperda Salivary Glucose Oxidase Reduces the Release of Green Leaf Volatiles and Increases Terpene Emission from Maize DOI Creative Commons
Bin Gao, Bin Li,

Jinxi Yuan

et al.

Insects, Journal Year: 2024, Volume and Issue: 15(7), P. 511 - 511

Published: July 8, 2024

The intricate relationships between plants and insects are essential for understanding ecological dynamics. Among these interactions, HIPVs serve as a pivotal defense mechanism. Our findings reveal the highly conserved nature of GOX gene within Lepidoptera order, expressed in salivary glands S. frugiperda, its role mediating maize’s responses. Notably, activity expression significantly decreases subsequent knockout. presence saliva frugiperda modulates emission during maize consumption. This research delineates that selectively inhibits certain green leaf volatiles (GLVs) while concurrently enhancing release terpene volatiles. study unveils novel mechanism whereby utilizes proteins OS to modulate volatile emissions from maize, offering fresh perspectives on adaptive evolution phytophagous their interactions with preferred host plants.

Language: Английский

Citations

3
Carbon Nanodot–Microbe–Plant Nexus in Agroecosystem and Antimicrobial Applications DOI Creative Commons
József Prokisch, Duyen H. H. Nguyen, Arjun Muthu

et al.

Nanomaterials, Journal Year: 2024, Volume and Issue: 14(15), P. 1249 - 1249

Published: July 25, 2024

The intensive applications of nanomaterials in the agroecosystem led to creation several environmental problems. More efforts are needed discover new insights nanomaterial-microbe-plant nexus. This relationship has dimensions, which may include transport different plant organs, nanotoxicity soil microbes and plants, possible regulations. review focuses on challenges prospects nexus under conditions. previous nano-forms were selected this study because rare, published articles such nanomaterials. Under study's nexus, more carbon nanodot-microbe-plant discussed along with role frontier nano-tellurium-microbe Transport organs applications, translocation these nanoparticles besides their expected will be also reported current study. Nanotoxicity plants was investigated by taking account morpho-physiological, molecular, biochemical concerns. highlights regulations a focus risk at ecological level risks human health, scientific organizational levels. opens many windows studies near future.

Language: Английский

Citations

2
Transcriptomic insights into the potential impacts of flavonoids and nodule-specific cysteine-rich peptides on nitrogen fixation in Vicia villosa and Vicia sativa DOI

Jian Ren,

Zheng‐Guo Cui, Yueqiang Wang

et al.

Plant Physiology and Biochemistry, Journal Year: 2024, Volume and Issue: 214, P. 108936 - 108936

Published: July 14, 2024

Language: Английский

Citations

1
The emergence and loss of cyclic peptides in Nicotiana illuminate dynamics and mechanisms of plant metabolic evolution DOI Open Access

Elliot M. Suh,

Jakob K. Reinhardt, Jing‐Ke Weng

et al.

bioRxiv (Cold Spring Harbor Laboratory), Journal Year: 2024, Volume and Issue: unknown

Published: Dec. 1, 2024

Specialized metabolism plays a central role in how plants cope with both biotic and abiotic stresses order to survive reproduce within dynamic challenging environments. One recently circumscribed class of plant-specific, ribosomally synthesized post-translationally modified peptides are the burpitides, which characterized by installation distinct sidechain macrocycles enzymes known as burpitide cyclases. While they found across many plant families exhibit diverse bioactivities, little is about their evolution or new variants arise. Here we present discovery cyclase, resurrected from defunct pseudogene model organism Nicotiana attenuata, coyote tobacco. By repairing ΨNatBURP2 expressing it heterologously benthamiana, successfully reconstituted its original enzymatic activity. As an autocatalytic peptide installs unique C-C bond between tyrosine side chain specific backbone a-carbon heptapeptide core motif, resulting dubbed "nanamin." Despite pseudogenization N. that closely related species, clevelandii, retains wild-type gene produces nanamins. Phylogenetic analyses targeted mutagenesis experiments reveal this chemotype must have evolved duplication neofunctionalization more promiscuous ancestral gene. This work highlights novel chemotypes may rapidly emerge disappear plants, while expanding molecular toolkit for engineering applications agriculture drug discovery.

Language: Английский

Citations

0
Managing tomato bacterial wilt through pathogen suppression and host resistance augmentation using microbial peptide DOI Creative Commons

Ishan Tiwari,

Ali Asger Bhojiya, Devendra Jain

et al.

Frontiers in Microbiology, Journal Year: 2024, Volume and Issue: 15

Published: Dec. 11, 2024

The increasing health and environmental risks associated with synthetic chemical pesticides necessitate the exploration of safer, sustainable alternatives for plant protection. This study investigates a novel biosynthesized antimicrobial peptide (AMP) from Lactiplantibacillus argentoratensis strain IT, identified as amino acid chain PRKGSVAKDVLPDPVYNSKLVTRLINHLMIDGKRG, its efficacy in controlling bacterial wilt (BW) disease tomato ( Solanum lycopersicum ) caused by Ralstonia solanacearum . Our research demonstrates that foliar application this AMP at concentration 200 ppm significantly reduces incidence 49.3% severity 45.8%. Scanning electron microscopy revealed severe morphological disruptions cells upon exposure to AMP. Additionally, enhanced host resistance elevating defense enzyme activities, leading notable improvements morphology, including 95.5% increase length, 20.1% biomass, 96.69% root length. bifunctional provides dual protection exerting direct activity against pathogen eliciting mechanisms. These findings underscore potential biologically sourced natural agent combating diseases promoting growth crops. To best our knowledge, is first demonstrate use spray microbial biocontrol R. interaction not only highlights but also role thereby overall agricultural yield.

Language: Английский

Citations

0