Phytomedicine, Journal Year: 2023, Volume and Issue: 118, P. 154948 - 154948
Published: July 2, 2023
Language: Английский
动物学研究, Journal Year: 2023, Volume and Issue: 45(1), P. 108 - 124
Published: Sept. 5, 2023
Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (
Language: Английский
Citations
8
Frontiers in Pharmacology, Journal Year: 2024, Volume and Issue: 15
Published: June 21, 2024
Parkinson's disease (PD) is a common and slow-progressing neurodegenerative disorder characterized by motor non-motor symptoms, including gastrointestinal (GI) dysfunctions. Over the last years, microbiota-gut-brain (MGB) axis emerging as bacterial-neuro-immune ascending pathway that contributes to progression of PD. Indeed, PD patients are changes in gut microbiota composition, alterations intestinal epithelial barrier (IEB) enteric neurogenic/inflammatory responses that, besides determining disturbances, contribute brain pathology. In this context, despite causal relationship between dysbiosis, impaired MGB remains be elucidated, evidence shows modulation can represent suitable therapeutical strategy for treatment This review provides an overview available knowledge about beneficial effects gut-directed therapies, dietary interventions, prebiotics, probiotics, synbiotics fecal transplantation (FMT), both animal models. particular attention has been devoted mechanisms which could halt or slow down pathology and, most importantly, how these approaches included clinical practice.
Language: Английский
Citations
2
Journal of Parkinson s Disease, Journal Year: 2024, Volume and Issue: 14(7), P. 1507 - 1518
Published: Aug. 23, 2024
There is increasing evidence that microbial-based therapies can be useful in people with Parkinson’s disease (PD). In this viewpoint, we provide a state-of-the-art review of the clinical and pre-clinical for probiotics prebiotics PD. Currently, short-term studies, including double-blind placebo-controlled randomized trials, have demonstrated safety, efficacy primarily improving constipation-related symptoms. Pre-clinical studies consistently reported improvements range biological markers outcomes, attenuation gut dysfunction neuroprotection. Bacteria from genus Lactobacillus Bifidobacterium been most frequently studied both while research into still limited involved resistant starch fructooligosaccharides. We practical suggestions clinicians on how to advise patients clinic regarding these popular treatments, important caveats aware of. Finally, areas further advancements are highlighted. It envisaged future, may benefit personalization based an enhanced understanding whole host factors host-microbiome interactions.
Language: Английский
Citations
2
Chinese Medical Journal, Journal Year: 2024, Volume and Issue: unknown
Published: Nov. 6, 2024
Abstract Emerging evidence suggests that dysbiosis of the gut microbiota is associated with pathogenesis Parkinson’s disease (PD), a prevalent neurodegenerative disorder. The microbiota–gut–brain axis plays crucial role in development and progression PD, numerous studies have demonstrated potential therapeutic benefits modulations intestinal microbiota. This review provides insights into characterization patients PD highlights associations clinical symptoms underlying mechanisms. discussion underscores increased influence PD. While relationship not fully elucidated, existing research demonstrates strong correlation between changes composition development, further investigation warranted to explain specific
Language: Английский
Citations
2
Phytomedicine, Journal Year: 2023, Volume and Issue: 118, P. 154948 - 154948
Published: July 2, 2023
Language: Английский
Citations
4