Generation of porcine circovirus type 4 virus-like particles and their use to detect serum antibodies DOI Creative Commons

Zheng Fang,

Mingxia Sun,

Shanghui Wang

et al.

Research Square (Research Square), Journal Year: 2023, Volume and Issue: unknown

Published: Aug. 11, 2023

Abstract Porcine Circovirus type 4 (PCV4), first identified in 2019 as a newly emerging pathogen, has been found several provinces of China, well Korea and Thailand. Since PCV4 is not included immunization programs, epidemiological investigations should be conducted for PCV4-positive antibodies detection. Virus-like particles (VLPs) are commonly employed serological analysis pathogen infections. However, there no reports on using VLPs infection investigation. In this study, we successfully generated self-assembled an E.coli expression system purified the through two-step purification process. Subsequently, utilized encapsulated antigens to develop indirect ELISA. The established ELISA method showed high specificity, sensitivity, repeatability, making it suitable investigation serum samples. Finally, was applied detect 422 samples from regions which 134 tested positive. Therefore, PCV4-VLPs-based could effectively against samples, contributing better understanding epidemiology.

Language: Английский

Development of a duplex real-time recombinase aided amplification assay for the simultaneous and rapid detection of PCV3 and PCV4 DOI Creative Commons

Renjie Sun,

Hanze Liu,

Siqi Sun

et al.

Virology Journal, Journal Year: 2025, Volume and Issue: 22(1)

Published: Feb. 1, 2025

Porcine circoviruses 3 (PCV3) and 4 (PCV4) are emerging pathogens with global implications for swine industry, disturbing the diagnosis of PCVs associated diseases due to a range similar clinical symptoms increasingly coinfections. A rapid accurate method detection PCV3 PCV4 is critical controlling transmission disease. We developed duplex real-time recombinase aided amplification (RAA) assay both simultaneously. The was completed within 20 min at 39℃ designed optimal primers probes. established more convenient simpler operation compared conventional molecular biological assays. achieved limit 73.67 copies/reaction each circovirus (at 95% probability by probit regression analysis) showed high specificity no cross-reactivity other important porcine viruses (including PCV2). intra- inter-group coefficients variation (CV) were ranged from 2.08 4.97%, indicating stability reliability. Comparative analysis qPCR on 60 samples artificially spiked indicated congruence (the kappa value 0.966 1, respectively, p < 0.001), only minor discrepancies, validating effectiveness RAA in detecting co-infections its suitability preliminary PCV4. This study provides robust basis multiplex veterinary using technique, enhancing field's capacity control PCV4, supporting reliable aid epidemiological understanding circoviruses.

Language: Английский

Citations

1

First molecular detection and genetic characterization of porcine circovirus 4 in the Gansu Province of China DOI Creative Commons
Peng-Fei Fu, Yan‐Hong Wang,

Guo Liu

et al.

PLoS ONE, Journal Year: 2024, Volume and Issue: 19(2), P. e0293135 - e0293135

Published: Feb. 5, 2024

Since its initial discovery in the Hunan province of China, genomic DNA porcine circovirus 4 (PCV4) has been detected pigs across multiple provinces as well South Korea. However, prevalence type Gansu Province, remains unknown. To address this gap, we undertook an extensive study where gathered 121 clinical samples displaying diverse manifestations from pig farms Province between 2022 and 2023. Employing a real-time fluorescence quantification method, identified presence PCV4 genome. Out analyzed, 13 tested positive for PCV4, resulting rate 10.74% (13/121). This finding confirms within China. Furthermore, successfully sequenced analyzed complete genomes two distinct strains, comparing them with 60 reference sequences archived GenBank database. The results revealed high nucleotide homology (98.2–98.8%) strains obtained indicating relatively low evolutionary Phylogenetic analysis that belong to PCV4a PCV4c. As far know, marks inaugural report on molecular identification attributes offering valuable insights devising preventive control strategies against emerging virus.

Language: Английский

Citations

5

Generation of porcine circovirus type 4 virus-like particles and their use to detect serum antibodies DOI

Zheng Fang,

Yabin Tu, Mingxia Sun

et al.

Archives of Virology, Journal Year: 2024, Volume and Issue: 169(3)

Published: March 1, 2024

Language: Английский

Citations

2

Molecular detection and genetic characteristics of porcine circovirus 3 and porcine circovirus 4 in central China DOI

Linqing Wang,

Jia-Xin Li, Xi-Meng Chen

et al.

Archives of Virology, Journal Year: 2024, Volume and Issue: 169(5)

Published: May 1, 2024

Language: Английский

Citations

1

The Nuclear Localization Signal of Porcine Circovirus Type 4 Affects the Subcellular Localization of the Virus Capsid and the Production of Virus-like Particles DOI Open Access
Jiawei Zheng, Nan Li, Xue Li

et al.

International Journal of Molecular Sciences, Journal Year: 2024, Volume and Issue: 25(5), P. 2459 - 2459

Published: Feb. 20, 2024

Porcine circovirus 4 (PCV4) is a newly identified virus belonging to PCV of the Circoviridae family, Circovirus genus. We previously found that PCV4 pathogenic in vitro, while virus’s replication cells still unknown. In this study, we evaluated N-terminal capsid (Cap) and an NLS at amino acid residues 4–37 N-terminus Cap, 4RSRYSRRRRNRRNQRRRGLWPRASRRRYRWRRKN37. The was further divided into two fragments (NLS-A NLS-B) based on predicted structure, including α-helixes, which were located 4RSRYSRRRRNRRNQRR19 24PRASRRRYRWRRK36, respectively. Further studies showed NLS, especially first α-helixes formed by NLS-A fragment, determined nuclear localization Cap protein, 4RSRY7 critical motif affecting VLP packaging. These results will provide theoretical basis for elucidating infection mechanism developing subunit vaccines VLPs.

Language: Английский

Citations

1

First report on identification and genomic analysis of a novel porcine circovirus (porcine circovirus 4) in cats DOI Creative Commons
Tong Xu,

Lishuang Deng,

Zhijie Jian

et al.

Frontiers in Microbiology, Journal Year: 2023, Volume and Issue: 14

Published: Sept. 22, 2023

Porcine circovirus type 4 (PCV4) is an emerging circovirus, which has been detected in domestic pigs across various provinces China and Korea. In this study, we aimed to investigate whether cats are susceptible PCV4. For purpose, collected 116 cat samples from animal hospitals Sichuan Province, China, between 2021 2022. Using a SYBR Green-based real-time PCR assay, PCV4 5 out of the clinical samples, indicating positive rate 4.31% (5/116) confirming presence China. Moreover, successfully sequenced analyzed complete genome one strain (SCGA-Cat) along with 60 reference sequences deposited GenBank database. SCGA-Cat exhibited high nucleotide homology (98.2-99.0%) strains other species, including dogs, pigs, dairy cows, fur animals. Notably, clustered closely derived pig Fujian To best our knowledge, study represents first report on molecular detection worldwide, prompted us understand genetic diversity cross-species transmission ongoing cases. However, further investigations needed explore association infection syndromes cats.

Language: Английский

Citations

2

UNVEILING THE GENOMIC DIVERSITY OF PORCINE CIRCOVIRUS 4 BY BIOINFORMATICS ANALYSIS DOI Open Access
Lukumoni Buragohain, Arpita Bharali, Nagendra Nath Barman

et al.

Global Journal For Research Analysis, Journal Year: 2024, Volume and Issue: unknown, P. 82 - 83

Published: April 15, 2024

Porcine Circovirus 4 (PCV4) is the latest type of Circoviruses (PCVs) and found to be associated with several clinical manifestations in pigs, although exact pathogenesis still unclear. This study aims reveal genetic diversity different strains PCV4 that were detected locations. Accordingly, seventy numbers complete genome 13 sequences other PCVs retrieved from public database phylogenetic analysis, pairwise identity intergenomic analysis done online offline bioinformatics tools. Phylogenetic showed formed a separate clade variation among between 0.0-2.3%. The presented this will helpful conduct future research designing molecular diagnostics for detection PCV4, however, more detailed required better genomic characterization virus.

Language: Английский

Citations

0

Generation of porcine circovirus type 4 virus-like particles and their use to detect serum antibodies DOI Creative Commons

Zheng Fang,

Mingxia Sun,

Shanghui Wang

et al.

Research Square (Research Square), Journal Year: 2023, Volume and Issue: unknown

Published: Aug. 11, 2023

Abstract Porcine Circovirus type 4 (PCV4), first identified in 2019 as a newly emerging pathogen, has been found several provinces of China, well Korea and Thailand. Since PCV4 is not included immunization programs, epidemiological investigations should be conducted for PCV4-positive antibodies detection. Virus-like particles (VLPs) are commonly employed serological analysis pathogen infections. However, there no reports on using VLPs infection investigation. In this study, we successfully generated self-assembled an E.coli expression system purified the through two-step purification process. Subsequently, utilized encapsulated antigens to develop indirect ELISA. The established ELISA method showed high specificity, sensitivity, repeatability, making it suitable investigation serum samples. Finally, was applied detect 422 samples from regions which 134 tested positive. Therefore, PCV4-VLPs-based could effectively against samples, contributing better understanding epidemiology.

Language: Английский

Citations

0