Traditional Chinese decoction Si Zhi Wan attenuates ovariectomy (OVX)-induced bone loss by inhibiting osteoclastogenesis and promoting apoptosis of mature osteoclasts DOI Creative Commons

Qingman He,

Kanghua Fu,

Huan Yao

et al.

Frontiers in Pharmacology, Journal Year: 2022, Volume and Issue: 13

Published: Sept. 13, 2022

Si Zhi Wan (SZW) is a traditional Chinese decoction used for osteoporosis treatment. Currently, the effect of SZW on ovariectomy (OVX)-induced bone loss and underlying mechanisms remain unknown. Herein, we investigated therapeutic explored in vitro vivo. An OVX-induced model was established After administration 8 weeks, rats were sacrificed, uterus weighted to calculate its index. The femur change pathologically evaluated using hematoxylin eosin (H&E) staining. mineral density observed by micro-CT. RAW264.7 cells activated receptor activator nuclear factor-κB ligand (RANKL) vitro. osteoclastogenesis tartrate-resistant acid phosphatase (TRAP) staining, Western blotting, RT-PCR. pro-apoptosis mature osteoclasts examined after induction osteoclast maturation. Finally, NF-κB pathway evaluated. Our results demonstrated that ameliorated rats. In addition, inhibited attenuated osteoclast-mediated resorption also promoted apoptosis osteoclasts. Mechanically, exerts effects suppressing pathway. Overall, these findings may be potentially effective alternative treatment osteoporosis.

Language: Английский

Myocardial ischemia-reperfusion injury: The balance mechanism between mitophagy and NLRP3 inflammasome DOI
Li Chen, Linshen Mao,

Jin-Yi Xue

et al.

Life Sciences, Journal Year: 2024, Volume and Issue: 355, P. 122998 - 122998

Published: Aug. 20, 2024

Language: Английский

Citations

5
Recent insights into the effect of endoplasmic reticulum stress in the pathophysiology of intestinal ischaemia‒reperfusion injury DOI
Jianmin Zhang, Xiaohui Zhang, Yongqiang Liu

et al.

Biochemical and Biophysical Research Communications, Journal Year: 2024, Volume and Issue: 701, P. 149612 - 149612

Published: Feb. 1, 2024

Language: Английский

Citations

4
Ginsenoside Rg3 attenuates myocardial ischemia/reperfusion-induced ferroptosis via the keap1/Nrf2/GPX4 signaling pathway DOI Creative Commons

Guofu Zhong,

Junteng Chen,

Yangtao Li

et al.

BMC Complementary Medicine and Therapies, Journal Year: 2024, Volume and Issue: 24(1)

Published: June 26, 2024

Abstract Background Ginsenoside Rg3 is a component of ginseng that protects against myocardial ischemia/reperfusion (MI/R) injury. Ferroptosis new form cell death characterized by oxidative damage to phospholipids. The purpose this study was examine the role and ginsenoside in MI/R mechanism. Methods A mouse model left anterior descending (LAD) ligation-induced injury oxygen-glucose deprivation/reperfusion (OGD/R) were used as vitro vivo models, respectively. Echocardiographic analysis, 2,3,5-triphenyltetrazolium chloride (TTC) staining hematoxylin-eosin (H&E) assess cardioprotective effects Rg3. Western blotting, biochemical small interfering RNA analysis molecular docking performed underlying Results improved cardiac function infarct size mice with Moreover, increased expression ferroptosis-related protein GPX4 inhibited iron deposition also activated Nrf2 signaling pathway. attenuated ischemia/reperfusion-induced ferroptosis via Notably, regulated keap1/Nrf2 pathway attenuate OGD/R-induced H9C2 cells. Taken together, keap1/Nrf2/GPX4 Conclusions Our findings demonstrated ameliorate MI/R-induced

Language: Английский

Citations

4
Serine/threonine kinase 3 promotes oxidative stress and mitochondrial damage in septic cardiomyopathy through inducing Kelch-like ECH-associated protein 1 phosphorylation and nuclear factor erythroid 2-related factor 2 degradation DOI Creative Commons
Hang Zhu,

Zhe Dai,

Xiaoman Liu

et al.

International Journal of Biological Sciences, Journal Year: 2023, Volume and Issue: 19(5), P. 1369 - 1381

Published: Jan. 1, 2023

Serine/threonine kinases (STK3) is a core component of the Hippo pathway and modulates oxidative stress inflammatory responses in cardiovascular diseases.However, its potential role septic cardiomyopathy remains undefined.STK3-mediated phosphorylation Kelch-like ECH-associated protein 1 (KEAP1) was shown to suppress antioxidant gene transcription controlled by nuclear factor erythroid 2-related 2 (Nrf2) macrophages.To explore whether STK3 induces KEAP1-mediated suppression Nrf2 cardiomyopathy, wild-type global knockout (STK3 -/-) mice were treated with LPS.LPS treatment upregulated cardiac expression.STK3 deletion attenuated myocardial inflammation cardiomyocyte death, improved structure function.In LPS-challenged HL-1 cardiomyocytes, shRNA-mediated knockdown normalized mitochondrial membrane ATP production, apoptosis, rescued expression preventing downregulation.Co-IP, docking analysis, western blotting, immunofluorescence assays further showed that binds phosphorylates KEAP1, promoting downregulation.Accordingly, transfection phosphodefective KEAP1 mutant restored performance upon LPS, while phosphomimetic abolished mitochondria-protective pro-survival effects deletion.These findings suggest upregulation contributes phosphorylating promote degradation response.

Language: Английский

Citations

11
Effects of borneol on apoptosis of hypoxia/reoxygenation H9c2 cells and myocardial ischemia-reperfusion injury rats DOI Creative Commons
Hui Zhang,

Junfang Dong,

Jianwu Zhang

et al.

Acta Cirúrgica Brasileira, Journal Year: 2025, Volume and Issue: 40

Published: Jan. 1, 2025

ABSTRACT Purpose: To explore the protective effects of borneol in myocardial ischemia-reperfusion injury (MIRI) and mechanism apoptosis. Methods: Cell viability was detected by CCK-8. The total superoxide dismutase (T-SOD) lactate dehydrogenase (LDH) leakage cells were tested biochemical assay kit. Detection apoptosis flow cytometry. Serum levels creatine kinase isoenzyme MB (CK-MB), LDH, cardiac troponin I (cTnI) enzyme-linked immunosorbent assay. Myocardial infarction area pathological changes observed via 2,3,5-triphenyltetrazolium chloride (TTC) staining hematoxylin eosin staining. expressions apoptosis-related proteins tissues Western blot. Results: H9c2 cell significantly increased pretreatment with 16 32 μg/mL borneol. Borneol T-SOD reduced LDH In MIRI rats, serum CK-MB, cTnI, decreased area, improved different degree. blot results showed that expression Bcl-2-associated X protein (Bax) Cysteine-aspartate protease-3 (Caspase-3) rats. Conclusion: can protect mitigate inhibiting cardiomyocyte

Language: Английский

Citations

0
Cath-KP, a novel peptide derived from frog skin, prevents oxidative stress damage in a Parkinson’s disease model DOI Open Access

Huanpeng Lu,

Jinwei Chai, Zijian Xu

et al.

动物学研究, Journal Year: 2023, Volume and Issue: 45(1), P. 108 - 124

Published: Sept. 5, 2023

Parkinson's disease (PD) is a neurodegenerative condition that results in dyskinesia, with oxidative stress playing pivotal role its progression. Antioxidant peptides may thus present therapeutic potential for PD. In this study, novel cathelicidin peptide (Cath-KP; GCSGRFCNLFNNRRPGRLTLIHRPGGDKRTSTGLIYV) was identified from the skin of Asiatic painted frog (

Language: Английский

Citations

9
Salvianolic acid B promotes angiogenesis and inhibits cardiomyocyte apoptosis by regulating autophagy in myocardial ischemia DOI Creative Commons
Qi Chen,

Qing‐Yang Xu,

Huilin Zhu

et al.

Chinese Medicine, Journal Year: 2023, Volume and Issue: 18(1)

Published: Nov. 28, 2023

Myocardial ischemia (MI) can cause angina, myocardial infarction, and even death. Angiogenesis is beneficial for ensuring oxygen blood supply to ischemic tissue, promoting tissue repair, reducing cell damage. In this study, we evaluated the effects of Salvianolic acid B (Sal B) against explored its underlying mechanism on autophagy.The anti-apoptosis effect Sal was conducted by staining Annexin V-FITC/PI Hoechst as well evaluating apoptosis bio-markers at protein level in H9c2 cells glucose deprivation condition. HUVECs were co-cultured with H9c2, tube formation assay used monitor B's impact angiogenesis. The MI model mice induced intraperitoneal injection isoproterenol (ISO). HE, Masson, immunohistochemistry, WB kits. addition, Atg5 siRNA applied verify whether protective regulated autophagy.In reduced levels lactate dehydrogenase (LDH), malondialdehyde (MDA) reactive species (ROS), improved superoxide dismutase (SOD) mitochondrial membrane potential, downregulated expressions Bax cleaved-Caspase3, upregulated expression Bcl-2. Therefore, could significantly inhibit damage caused deprivation. co-culture system HUVECs, vascular endothelial growth factor (VEGF) supernatant dramatically raised B. VEGF, platelet derived (PDGF) marker CD31. It implied that exerted a significant pro-angiogenic effect. Moreover, increased LC3, Atg5, Beclin1, while P62. When inhibited, angiogenesis reversed.Sal inhibited cardiomyocyte promoted regulating autophagy, thereby improving MI.

Language: Английский

Citations

9
Pharmacological therapy to cerebral ischemia-reperfusion injury: Focus on saponins DOI Open Access
Miao Zeng, Ruifeng Zhang,

Qiuyue Yang

et al.

Biomedicine & Pharmacotherapy, Journal Year: 2022, Volume and Issue: 155, P. 113696 - 113696

Published: Sept. 16, 2022

Secondary insult from cerebral ischemia-reperfusion injury (CIRI) is a major risk factor for poor prognosis of ischemia. Saponins are steroid or triterpenoid glycosides with various pharmacological activities that effective in treating CIRI. By browsing the literature 2001 to 2021, 55 references involving 24 kinds saponins were included. shown relieve CIRI by inhibiting oxidation stress, neuroinflammation, and apoptosis, restoring BBB integrity, promoting neurogenesis angiogenesis. This review summarizes classifies several common their mechanisms relieving Information provided this will benefit researchers design, research develop new medicines treat CIRI-related conditions saponins.

Language: Английский

Citations

13
Potential Targets of Natural Products for Improving Cardiac Ischemic Injury: The Role of Nrf2 Signaling Transduction DOI Creative Commons
Haixia Wang, Juanjuan Han, D.О. Gorbachev

et al.

Molecules, Journal Year: 2024, Volume and Issue: 29(9), P. 2005 - 2005

Published: April 26, 2024

Myocardial ischemia is the leading cause of health loss from cardiovascular disease worldwide. and hypoxia during exercise trigger risk sudden death which, in severe cases, will further lead to myocardial infarction. The Nrf2 transcription factor an important antioxidant regulator that extensively engaged biological processes such as oxidative stress, inflammatory response, apoptosis, mitochondrial malfunction. It has a significant role prevention treatment several illnesses, since it can control not only expression genes, but also target genes associated pathological processes. Therefore, targeting have great potential ischemic injury. Natural products are widely used treat diseases because their few side effects. A large number studies shown be way for natural alleviate ischemia. However, specific related mechanism mediating still unclear. this review combs key possible injury, emphatically summarizes treating symptoms, thus providing broad foundation clinical transformation.

Language: Английский

Citations

2
Puerarin-Loaded Liposomes Co-Modified by Ischemic Myocardium-Targeting Peptide and Triphenylphosphonium Cations Ameliorate Myocardial Ischemia-Reperfusion Injury DOI Creative Commons
Yan Wang, Fengmei Li,

Shanshan Wei

et al.

International Journal of Nanomedicine, Journal Year: 2024, Volume and Issue: Volume 19, P. 7997 - 8014

Published: Aug. 1, 2024

Mitochondrial damage may lead to uncontrolled oxidative stress and massive apoptosis, thus plays a pivotal role in the pathological processes of myocardial ischemia-reperfusion (I/R) injury. However, it is difficult for drugs such as puerarin (PUE) reach mitochondrial lesion due lack targeting ability, which seriously affects expected efficacy drug therapy I/R

Language: Английский

Citations

2